PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca30753.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 313aa    MW: 36334.1 Da    PI: 7.5482
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca30753.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1821.5e-5661331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtdeelv +yLk+k++g+k++l e+i+evd+yk+ePw+Lp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s + 
  Dca30753.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIDL-EIIPEVDLYKCEPWELPcKsILPSKDMEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNS-QV 102
                 79****************************.99***************6434556888*************************************9.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 ++vg+kktLv+y+grap+g++t Wvmheyrl
  Dca30753.1 103 RAVGMKKTLVYYRGRAPHGHRTGWVMHEYRL 133
                 99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-594138IPR003441NAC domain
PROSITE profilePS5100555.1026159IPR003441NAC domain
PfamPF023658.8E-317133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIDLEIIPE VDLYKCEPWE LPCKSILPSK  60
DMEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QVRAVGMKKT LVYYRGRAPH  120
GHRTGWVMHE YRLDERECEI ANGFQNHGEE YGTIPVEDPS ILRGQHVTDE YKTDNDFHEF  180
VNDSDPSKSF INDDDDIDNF SDTPNFDVFE EVEVNHNLYI SSKWLAETRF HQVQPTKTVQ  240
VYLQRAKLSQ NTPITTFKGD QCHTKPSAVC RIVRFARNCK VDGMLSNLFV ARVWPSMTVV  300
LALCTLWANQ ITL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-52113512144NO APICAL MERISTEM PROTEIN
1ut4_B1e-52113512144NO APICAL MERISTEM PROTEIN
1ut7_A1e-52113512144NO APICAL MERISTEM PROTEIN
1ut7_B1e-52113512144NO APICAL MERISTEM PROTEIN
3swm_A1e-52113515147NAC domain-containing protein 19
3swm_B1e-52113515147NAC domain-containing protein 19
3swm_C1e-52113515147NAC domain-containing protein 19
3swm_D1e-52113515147NAC domain-containing protein 19
3swp_A1e-52113515147NAC domain-containing protein 19
3swp_B1e-52113515147NAC domain-containing protein 19
3swp_C1e-52113515147NAC domain-containing protein 19
3swp_D1e-52113515147NAC domain-containing protein 19
4dul_A1e-52113512144NAC domain-containing protein 19
4dul_B1e-52113512144NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694967.12e-97PREDICTED: NAC domain-containing protein 86-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.18e-88NAC domain containing protein 28